Cat: PA2000-1804

Recombinant Human CRISPLD2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRISPLD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRISPLD2;CRISP11;LCRISP2;Cysteine-rich secretory Protein LCCL domain-containing 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H0B8

  • Expression Region

    23-497aa

  • AA Sequence

    YLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQP QASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYR SPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNK IGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECP PSYGGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRP TKPKKTSAVNYMTQVVRCDTKMKDRCKGSTCNRYQCPAGCLNHKAKIFGT LFYESSSSICRAAIHYGILDDKGGLVDITRNGKVPFFVKSERHGVQSLSK YKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPS YWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSL RNGVQSESLGTPRDGKAFRIFAVRQ

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRISPLD2, or cysteine-rich secretory protein LDC-2, is a member of the Cysteine-rich secretory protein family involved in various biological processes, including cell signaling, immune response, and cellular development. Emerging research has highlighted the potential role of CRISPLD2 in modulating inflammation and tissue repair, making it a focal point for studies related to autoimmune diseases, wound healing, and cancer. Understanding the structure and function of CRISPLD2 at the molecular level has generated interest in producing recombinant CRISPLD2 proteins, which can serve as valuable tools for exploring its pathways and mechanisms in various physiological and pathological contexts. By employing techniques like recombinant DNA technology, researchers aim to produce functional CRISPLD2 proteins to assess their biological activities and therapeutic potential. Additionally, studying the interaction of CRISPLD2 with other proteins may provide insights into its role in cellular communication and disease progression. Overall, the research on CRISPLD2 recombinant proteins not only contributes to our understanding of fundamental biological processes but also paves the way for the development of novel therapeutic strategies targeting diseases where CRISPLD2 is implicated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US