Analytical Data
-
Gene name
GSDMC
- Application
-
Alternative Names
GSDMC；MLZE；Gasdermin-C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYG8
-
Expression Region
1-508aa
-
AA Sequence
MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA
-
Molecular Weight
73.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The GSDMC (Gasdermin C) protein is part of the gasdermin family, which is known for its role in regulating pyroptosis, a form of programmed cell death associated with inflammatory responses. Emerging research has highlighted GSDMC's potential involvement in various physiological and pathological processes, including immunity, cancer, and neurodegenerative diseases. Understanding the structure and function of GSDMC can provide insights into its mechanism of action and how it interacts with other cellular components. Recent studies have focused on the recombinant expression of GSDMC to elucidate its functional properties, as well as to explore its potential as a therapeutic target. By generating recombinant GSDMC, researchers aim to characterize its pore-forming activity, assess its role in inflammatory signaling pathways, and investigate how it may promote or inhibit tumor progression. As such, GSDMC has garnered attention for its possible implications in disease mechanisms, offering a promising avenue for the development of novel therapeutic strategies aimed at modulating pyroptosis and related inflammatory processes. This growing interest in GSDMC underscores the need for further exploration of its biochemical characteristics and therapeutic potential, paving the way for innovative approaches to combat inflammation and cancer.
