Analytical Data
-
Gene name
C10orf10
- Application
-
Alternative Names
Protein DEPP1. Decidual Protein induced by progesterone. Fasting-induced gene Protein. FIG
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NTK1
-
Expression Region
1-212aa
-
AA Sequence
MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL
-
Molecular Weight
49.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C10orf10, also known as the "chromosome 10 open reading frame 10," is a gene of growing interest in the field of molecular biology and genetics due to its potential roles in various physiological processes and diseases. Research has highlighted C10orf10's involvement in cell signaling pathways, metabolic regulation, and the immune response, suggesting its importance in maintaining cellular homeostasis. Additionally, alterations in C10orf10 expression have been linked to several pathological conditions, including cancers and autoimmune disorders. The study of C10orf10-recombinant proteins offers valuable insights into the protein's structure-function relationships and its interactions within cellular contexts. Recombinant proteins can be used to elucidate the functional roles of C10orf10, facilitating the development of targeted therapeutic strategies and biomarkers for disease diagnosis. By employing techniques such as recombinant DNA technology, researchers can produce large quantities of this protein for in vitro and in vivo studies, allowing for a better understanding of its biochemical properties and potential applications in medicine. Overall, the investigation of C10orf10 and its recombinant forms represents a promising frontier in biomedical research, with implications for better understanding disease mechanisms and discovering innovative treatment avenues.
