Analytical Data
-
Gene name
CCDC134
- Application
-
Alternative Names
CCDC134;Coiled-coil domain-containing Protein 134
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6E4
-
Expression Region
23-229aa
-
AA Sequence
TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKG LFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRF PRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGIS EKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRI SRSQSELVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC134, or Coiled-Coil Domain Containing 134, is a protein that has garnered interest in recent years due to its potential roles in cellular processes and disease mechanisms. Research indicates that CCDC134 may be involved in the regulation of cellular structure and function, particularly through its coiled-coil domain, which is known to facilitate protein-protein interactions. This characteristic positions CCDC134 as a potential player in various signaling pathways and cellular activities, including those related to development and immune response. Moreover, mutations or dysregulation of CCDC134 have been implicated in certain genetic disorders and cancers, suggesting that understanding its function could provide insights into disease pathology and lead to novel therapeutic approaches. Researchers are currently focusing on exploring the biochemical properties, interactions, and specific cellular roles of CCDC134 to better delineate its contribution to both normal physiology and pathological conditions. Investigating this protein enhances our understanding of complex biological systems and holds promise for identifying targets for medical intervention. Overall, the study of CCDC134 represents a critical avenue for advancing molecular biology and translational medicine, contributing to the development of targeted therapies for conditions associated with its dysregulation.











