Cat: PA1000-3997

Recombinant Human TX8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TX8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STX8;Syntaxin-8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UNK0

  • Expression Region

    1-215aa

  • AA Sequence

    MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQN LKEKIALLKDLLLRA VSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEE AKRGAPNPWLFEEPE ETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN EIIDDLANLVENTDE KLRNETRRVNMVDRKSASCG

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TX8 recombinant protein, derived from a specific sequence of the TX8 gene, has garnered significant interest in the field of molecular biology and biotechnology due to its potential applications in therapeutics and diagnostics. The TX8 gene is known for its involvement in crucial cellular processes, which makes its protein product a candidate for further investigation in various diseases, particularly those related to metabolic disorders and cancer. Research has highlighted the structural and functional properties of TX8, demonstrating its role in cell signaling pathways and immune responses. Advances in recombinant DNA technology have enabled researchers to produce TX8 in vitro, allowing for detailed studies of its biochemical properties and interactions with other cellular components. Furthermore, the recombinant form of TX8 offers a platform for high-throughput screening of small molecules, aiding in drug discovery efforts. As we continue to understand the diverse functions of TX8 protein, its potential as a biomarker for disease and a target for therapeutic intervention becomes increasingly apparent, paving the way for innovative approaches in medical research and treatment strategies. The ongoing study of TX8 recombinant protein therefore represents a promising avenue for advancing our understanding of its biological significance and harnessing its utility in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US