Analytical Data
-
Gene name
BXDC1
- Application
-
Alternative Names
bA397G5.4; Brix domain containing 1; Brix domain containing Protein 1; Brix domain-containing Protein 1; BXDC1; homolog of Rpf2 (S. cerevesiae)
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H7B2
-
Expression Region
1-306aa
-
AA Sequence
MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN
-
Molecular Weight
62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BXDC1 is a newly identified recombinant protein that has garnered attention in the field of biomedical research due to its potential therapeutic applications. Initially discovered through genomic studies aimed at understanding gene expression and protein function in various cellular contexts, BXDC1 appears to play a significant role in cellular signaling pathways, and its dysregulation is associated with several diseases, including cancer and autoimmune disorders. As researchers delve deeper into its molecular characteristics, they have found that BXDC1 might influence key biological processes such as cellular proliferation, apoptosis, and immune responses. The recombinant production of BXDC1 allows for a detailed examination of its structure and function, thereby facilitating the development of targeted therapies that utilize BXDC1's unique properties. Furthermore, understanding BXDC1's interactions with other proteins and its localization within cells is crucial for elucidating its role in disease mechanisms. The ongoing studies not only aim to clarify BXDC1's biological functions but also explore its potential as a biomarker for disease diagnosis and prognosis, as well as a target for novel therapeutic strategies. Overall, the research into BXDC1 holds promise for advancing our understanding of disease pathology and improving patient outcomes through innovative treatment approaches.
