Analytical Data
-
Gene name
EPHA1
- Application
-
Alternative Names
EPHA1；EPH；Ephrin type-A receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21709
-
Expression Region
613-892aa
-
AA Sequence
LDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKDTS PGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDA FLREREDQLVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLC CKVSDFGLTRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSF GIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNC WAYDRARRPHFQKLQAHLEQLLANPHSLRT
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPHA1, a member of the Eph receptor tyrosine kinase family, plays a crucial role in various biological processes, including cell migration, differentiation, and tissue morphology. Its involvement in neurogenesis, angiogenesis, and the regulation of the immune response has made EPHA1 a significant focus in cancer research, as altered expression or function of this receptor is often associated with tumor progression and metastasis. Given its promising role as a biomarker and therapeutic target, the study of EPHA1 recombinant protein has gained traction. Researchers are interested in understanding its signaling pathways and interactions with ephrin ligands, which can potentially reveal novel mechanisms of disease. Furthermore, the generation of EPHA1 recombinant proteins allows for the exploration of its structure-function relationships and the development of targeted therapies. By utilizing advanced techniques such as protein engineering and biotechnology, scientists aim to create stable and functional EPHA1 proteins that can be used in assays and experimental models. This research not only sheds light on the fundamental biology of EPHA1 but also paves the way for innovative approaches in cancer treatment and regenerative medicine, highlighting the therapeutic potential of manipulating this receptor's pathways. As studies progress, insights gained from EPHA1 recombinant protein research may contribute to the development of effective diagnostics and targeted therapies for diseases where EPHA1 plays a pivotal role.
