Analytical Data
-
Gene name
Mkrn3
- Application
-
Alternative Names
Mkrn3；D15S9；RNF63；ZNF127；Probable E3 ubiquitin-Protein ligase makorin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31947
-
Expression Region
1-248aa
-
AA Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
-
Molecular Weight
54.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Mkrn3, a gene located on chromosome 15, has garnered significant attention due to its crucial role in the development of various physiological processes, particularly in the regulation of growth and metabolism. This gene is known to encode a member of the Makorin family of proteins, which are characterized by their zinc-finger domains and are implicated in various cellular functions, including RNA binding and regulation of gene expression. Recent studies have linked mutations in Mkrn3 to disorders such as familial childhood obesity and other metabolic syndromes, underscoring its importance in energy homeostasis and appetite regulation. The investigation into the recombinant protein Mkrn3 is essential for understanding its biological function, exploring the underlying mechanisms of associated disorders, and identifying potential therapeutic targets. By producing recombinant Mkrn3 protein, researchers aim to elucidate its structural properties, interactions with other biomolecules, and its role in metabolic pathways. This research not only enhances our comprehension of Mkrn3's significance in human health but also contributes to the broader field of molecular endocrinology and metabolic diseases, paving the way for new interventions to manage obesity and related metabolic disorders. The ongoing exploration of Mkrn3 could lead to novel insights into the genetic and molecular bases of obesity, offering potential avenues for pharmacological innovations and personalized medicine approaches in the future.
