Analytical Data
-
Gene name
BRWD1
- Application
-
Alternative Names
Bromodomain and WD repeat domain containing Protein 1; Bromodomain and WD repeat-containing Protein 1; Brwd1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NSI6
-
Expression Region
1-120aa
-
AA Sequence
MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRWD1, or Bromodomain and WD Repeat Domain Containing 1, is a protein that has garnered significant attention in the field of molecular biology due to its essential role in various cellular processes, including transcription regulation, cell differentiation, and maintenance of genome integrity. This protein is characterized by the presence of bromodomains, which facilitate the recognition and binding of acetylated lysine residues on histones, thus influencing chromatin dynamics and gene expression. Dysregulation of BRWD1 has been implicated in several diseases, including cancer, making it a target of interest for therapeutic interventions. Recent studies have focused on the structural and functional characterization of BRWD1, including the development of recombinant forms of the protein to elucidate its mechanistic roles. The production of BRWD1 recombinant protein enables researchers to investigate its interactions with other cellular components and to assess its potential as a biomarker or therapeutic target. Understanding the precise functions and regulatory mechanisms of BRWD1 not only enhances our knowledge of epigenetic regulation but also contributes to the identification of new strategies for disease treatment, particularly in contexts where BRWD1 function is compromised. Through this research, advancements in biotechnology and medicine can be achieved, leading to improved outcomes for patients affected by BRWD1-related disorders.
