Analytical Data
-
Gene name
Hsd17b13
- Application
-
Alternative Names
Hsd17b13；SCDR9；SDR16C3；17-beta-hydroxysteroid dehydrogenase 13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z5P4
-
Expression Region
1-300aa
-
AA Sequence
MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGR QTTYEFAKRQSILVLWDINKRGVEETAAECRKLGVTAHAYVVDCSNREEI YRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHFW ITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLT SELQALGKTGIKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGI LTNKKMIFVPSYINIFLRLQKFLPERASAILNRMQNIQFEAVVGHKIKMK
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HSD17B13, a member of the 17β-hydroxysteroid dehydrogenase family, has gained significant attention in recent years due to its emerging role in lipid metabolism and liver function. Initially identified for its involvement in steroid hormone biosynthesis, HSD17B13 has been linked to various metabolic disorders, including non-alcoholic fatty liver disease (NAFLD) and liver cirrhosis. Genetic studies have revealed that specific single nucleotide polymorphisms (SNPs) in the HSD17B13 gene are associated with a reduced risk of liver diseases, suggesting a protective role against hepatic injury. Consequently, understanding the function and regulation of HSD17B13 could provide insights into potential therapeutic targets for liver diseases. Researchers are currently focusing on the characterization of recombinant HSD17B13 protein to elucidate its enzymatic activity, substrate specificity, and interactions with other metabolic pathways. This research is crucial for uncovering the mechanisms by which HSD17B13 influences lipid homeostasis and liver health, ultimately paving the way for novel interventions in liver-related disorders. The investigation of recombinant HSD17B13 protein will further enhance our understanding of its biological significance and open up new avenues for the development of strategies to mitigate liver disease progression.
