Analytical Data
-
Gene name
GITR
- Application
-
Alternative Names
GITR；AITR；Tumor necrosis factor receptor superfamily member 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5U5
-
Expression Region
26-161aa
-
AA Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCV QPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHE GHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GITR (Glucocorticoid-Induced TNFR-Related Protein) is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a critical role in regulating immune responses. It is primarily expressed on activated T cells, T regulatory cells, and various other immune cells. Research has shown that GITR engagement can enhance T cell proliferation and effector functions, making it a potential target for cancer immunotherapy. The therapeutic modulation of GITR signaling can improve anti-tumor immunity and overcome immune tolerance, which are significant barriers in cancer treatment. Given its pivotal role in immune regulation, the recombinant GITR protein has been explored for its ability to amplify immune responses against tumors. Scientists have developed various GITR-targeted therapies, including monoclonal antibodies and fusion proteins, to harness its immune-stimulating effects. Additionally, understanding the mechanisms underlying GITR signaling pathways can provide insights into developing strategies to optimize its therapeutic applications. Overall, the research on GITR and its recombinant forms is crucial for advancing immunotherapy approaches and enhancing the efficacy of cancer treatments.
