Analytical Data
-
Gene name
LAMP2
- Application
-
Alternative Names
LAMP2;Lysosome-associated membrane glycoProtein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13473
-
Expression Region
30-127aa
-
AA Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSIC GDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMP2 (Lysosomal Associated Membrane Protein 2) is a crucial protein that plays a significant role in lysosomal function and autophagy processes within cells. It exists in three isoforms, LAMP2A, LAMP2B, and LAMP2C, each contributing to different cellular functions, particularly in degrading and recycling cellular components. Research has highlighted the importance of LAMP2 in managing lysosomal stability and integrity, as well as its involvement in neurodegenerative diseases such as Pompe disease and Alzheimer's, where lysosomal dysfunction is a major pathological feature. The study of recombinant LAMP2 protein allows for a deeper understanding of its structure-function relationship, interactions with other cellular components, and its role in lysosomal biogenesis and autophagy regulation. By generating and characterizing recombinant LAMP2, researchers can explore therapeutic strategies aimed at restoring lysosomal function in diseases related to LAMP2 deficiency. Furthermore, understanding LAMP2's mechanism may provide insights into lysosomal storage disorders, potentially leading to the development of innovative treatments that target the underlying molecular causes of these conditions. This area of research is vital as it bridges cell biology and medical applications, emphasizing the therapeutic potential of targeting LAMP2-related pathways in various diseases.











