Analytical Data
-
Gene name
DHN1
- Application
-
Alternative Names
DHN1；Dehydrin DHN1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12951
-
Expression Region
1-139aa
-
AA Sequence
MEYQGQHGHATDKVEEYGQPVAGHGGFTGGPTGTHGAAGVGGAQLQATRDGHKTDGVLRRSGSSSSSSSEDDGVGGRRKKGMKEKIKEKLPGGAHKDAAGQQQQTAMAGEYAGTHGTEATGEKKGVMDKIKEKLPGGQH
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DHN1, or Dehydrin 1, is a protein belonging to the group of late embryogenesis abundant (LEA) proteins, which play a crucial role in plant stress response and tolerance mechanisms. Research into DHN1 has intensified due to its significant involvement in plant adaptation to various abiotic stresses such as drought, salinity, and cold. These environmental stressors trigger the accumulation of DHN1, which is believed to help protect cellular functions and stabilize cellular structures by preventing protein denaturation and aggregation. Studies indicate that DHN1 acts by forming a protective hydration shell around proteins and membranes, thus maintaining cellular integrity during stress conditions. Additionally, DHN1 has been linked to plant developmental processes, including seed maturation and germination. The exploration of DHN1 in genetic studies and protein engineering has potential applications in agricultural biotechnology, aiming to enhance crop resilience and yield in challenging environments. Understanding the molecular mechanisms and regulatory pathways associated with DHN1 can provide insights into developing transgenic plants with improved stress tolerance and adapting to climate change. Furthermore, investigating the interactions of DHN1 with other proteins and signaling pathways in plants is essential for elucidating its multifunctional roles in stress resilience and developmental processes. As such, DHN1 serves as a promising target for improving agricultural practices and ensuring food security in the context of global climate challenges.
