Analytical Data
-
Gene name
BM039
- Application
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A1G4P1D4
-
Expression Region
1-204aa
-
AA Sequence
MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN
-
Molecular Weight
48.18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BM039 is a recombinant protein that has garnered significant interest in the field of biotechnology due to its potential applications in therapeutic and diagnostic processes. The protein is derived from a specific biological source, where it is engineered to enhance its stability and functionality for various uses. Researchers are motivated to study BM039 because it exhibits properties that could improve drug delivery mechanisms, target-specific therapy, and biomarker identification. Its unique structural characteristics and interaction profiles open avenues for understanding complex biological pathways and diseases. Furthermore, the recombinant nature of BM039 ensures consistent production and scalability, making it a suitable candidate for industrial applications. Investigations into its efficacy, safety, and mechanism of action are essential to evaluate its potential in clinical settings. Overall, the research surrounding BM039 reflects a broader trend in the life sciences, where recombinant proteins are increasingly utilized to address unmet medical needs and advance personalized medicine.
