Cat: PAX2000-10376

Recombinant Human PLEC1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLEC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EBS1; EBSO; HD1; Hemidesmosomal protein 1; PCN; pleC; PLEC_HUMAN; PLEC1; PLEC1b; Plectin 1; Plectin 1 intermediate filament binding protein 500kDa; Plectin 6; Plectin; Plectin-1; PLTN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15149

  • Expression Region

    4384-4493   aa

  • AA Sequence

    CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA

  • Molecular Weight

    37.84 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLEC1 (plectin-1) is a cytoskeletal protein that plays a critical role in maintaining cellular structure and integrity by serving as a versatile linker between various components of the cytoskeleton and membrane-bound proteins. Its significance is highlighted in various physiological processes, including cell adhesion, migration, and signaling. Recent studies have shown that alterations in PLEC1 expression can be associated with several pathological conditions, including cancer, where it may influence tumor progression and metastasis. Moreover, PLEC1 has been implicated in specific cellular responses to stress and inflammation, making it a potential candidate for therapeutic interventions. The recombinant production of PLEC1 facilitates a detailed investigation into its structural and functional properties, providing insights into its interaction with other intracellular partners and its mechanistic role in health and disease. This research is particularly relevant in the context of developing targeted therapies, where understanding the molecular basis of PLEC1's function could lead to novel approaches in treating diseases linked to cytoskeletal dysfunctions. Advances in protein engineering and purification techniques have enabled the generation of high-quality recombinant PLEC1, which is essential for biochemical assays and structural studies, paving the way for future investigations into its role in cellular dynamics and its potential as a biomarker for disease characterization.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US