Analytical Data
-
Gene name
RSPO1
- Application
-
Alternative Names
RSPO1;R-spondin-1
-
Species
Pig
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A287AU43
-
Expression Region
1-262 aa
-
AA Sequence
MRLGLCVVALVLSWMHLAAGSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKESLYLHKGRCYPACPEGSAAANGTMECSSPAQCEMSEWSLWGPCSKKKKLCGFRRGLEERTRRVLQAPGGDHAICSDTKETRRCTVRRTPCPEGQKRRKGGQGRRENANRNPSRKEGKEAGAGARRRKGQQQQHQGTVGPITSAGPT
-
Molecular Weight
28,8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RSPO1 (R-spondin 1) is a secreted protein that plays a crucial role in the Wnt signaling pathway, a vital cellular communication mechanism implicated in various biological processes, including cell proliferation, differentiation, and stem cell maintenance. Disruptions in Wnt signaling have been associated with several diseases, including cancer and developmental disorders. Hence, RSPO1 has garnered attention for its potential therapeutic implications. Research has shown that RSPO1 acts as a ligand for the LGR (leucine-rich repeat-containing G protein-coupled receptors), enhancing Wnt signaling and promoting the growth of various tissues, particularly in the intestinal and reproductive systems. Studies have also indicated its role in sex determination and the development of reproductive organs. Understanding the structure and function of RSPO1, as well as the mechanisms underlying its signaling pathways, is essential for exploring its biological significance and therapeutic potential. Recent advances in recombinant protein technology have enabled the production of RSPO1 in various systems, facilitating in-depth studies of its properties and interactions. Moreover, characterizing RSPO1's effects on stem cell behavior could lead to novel approaches in regenerative medicine and cancer treatment, highlighting the importance of ongoing research in this area.











