Analytical Data
-
Gene name
ACVR2B
- Application
-
Alternative Names
ACVR2B；Activin receptor type-2B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13705
-
Expression Region
21-120aa
-
AA Sequence
RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTI ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACVR2B, a member of the transforming growth factor-beta (TGF-β) superfamily, plays a crucial role in muscle metabolism and growth regulation. It acts as a receptor for myostatin, a negative regulator of muscle mass, which has garnered significant interest in the fields of muscle biology and potential therapeutic applications. The importance of ACVR2B has been highlighted in studies revealing its involvement in muscle wasting disorders and age-related sarcopenia. Researchers have been exploring ACVR2B as a target for protein therapeutics to counteract muscle atrophy. Recombinant ACVR2B proteins have been developed and studied to understand their functional roles and interactions in cellular pathways that regulate muscle mass. Additionally, research has focused on utilizing ACVR2B inhibitors to promote muscle growth and improve physical performance in individuals experiencing muscle loss due to disease or disuse. The identification of ACVR2B as a key player in muscle regulation opens up avenues for innovative treatments aimed at reversing muscle degeneration and enhancing recovery from injuries, making it a significant focal point in contemporary biomedical research. As the understanding of ACVR2B's mechanisms progresses, it holds promise for developing new strategies to improve muscle health and combat related conditions.
