Analytical Data
-
Gene name
VMO1
- Application
-
Alternative Names
VMO1；Vitelline membrane outer layer Protein 1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z5L0
-
Expression Region
25-202aa
-
AA Sequence
QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPG DDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFS LRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGAC GLQTKIQGPRGLGDDTALNDARLFCCRSVDHHHHHH
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VMO1 (Vesicle-Mediated Organelle Transport 1) is a protein that has recently gained attention in the field of cellular biology due to its potential role in organelle transport and cellular homeostasis. Initially identified through genomic studies, VMO1 is believed to be involved in the regulation of intracellular vesicle trafficking, which is crucial for maintaining cellular functions such as metabolism, signaling, and growth. Its expression has been found in various tissues, suggesting a widespread significance in both normal physiological processes and pathological conditions. Recent studies indicate that VMO1 may play a role in cancer biology, particularly in tumor progression and metastasis, although the exact mechanisms are still under investigation. Researchers are increasingly focused on characterizing the functional properties of VMO1, including its interaction with other cellular components and its influence on organelle dynamics. As a potential biomarker and therapeutic target, understanding VMO1's structure and function could provide insights into novel strategies for treating diseases characterized by dysregulated vesicle transport, thereby contributing to the advancement of targeted therapies and personalized medicine approaches.
