Analytical Data
-
Gene name
AADAC
- Application
-
Alternative Names
AADAC；DAC；Arylacetamide deacetylase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22760
-
Expression Region
24-399aa
-
AA Sequence
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPP TSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALS GYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVL AKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQ PLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVE SSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLL ADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFH GAFSFLGLKISHRLINQYIEWLKENL
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AADAC (adipocyte-derived adrenal antagonistic peptide) is a protein that has garnered significant interest in the field of biochemistry and molecular biology due to its potential roles in metabolic regulation and disease modulation. Initially identified as a secreted protein from adipocytes, AADAC is thought to play a crucial role in lipid metabolism and energy homeostasis. Research has indicated that AADAC may interact with various metabolic pathways, influencing processes such as glucose homeostasis and insulin sensitivity. Furthermore, its involvement in inflammation and cardiovascular diseases has sparked curiosity about its therapeutic potential. The recombinant expression of AADAC allows for detailed studies of its structure-function relationships and interactions with other biomolecules, facilitating the exploration of its physiological roles. Advances in protein engineering and expression systems have enabled researchers to produce AADAC in a more efficient and cost-effective manner, which is critical for high-throughput screening and functional assays. Understanding the mechanisms by which AADAC operates could offer insights into potential applications in therapies for metabolic disorders and obesity-related conditions, making it a promising target for future research. The continued investigation of AADAC as a recombinant protein highlights the significance of post-translational modifications and the need for further studies to elucidate its biological functions and clinical relevance.
