Analytical Data
-
Gene name
Tnfrsf10b
- Application
-
Alternative Names
Tnfrsf10b；DR5；Tumor necrosis factor receptor superfamily member 10B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14763
-
Expression Region
54-210aa
-
AA Sequence
ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDY STHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMC RKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPG TPASPCS
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tnfrsf10b, also known as Death Receptor 5 (DR5), is a member of the tumor necrosis factor receptor superfamily that plays a crucial role in mediating apoptosis and regulating immune responses. It is primarily activated by its ligand TRAIL (TNF-related apoptosis-inducing ligand), making it a significant focus in cancer research due to its potential as a therapeutic target. Tumors often develop resistance to apoptosis, allowing for unchecked growth and progression; thus, enhancing the activity of DR5 can promote cancer cell death. Studies have shown that recombinant forms of Tnfrsf10b, produced through recombinant DNA technology, can effectively induce apoptosis in various cancer cell lines by mimicking the action of TRAIL. This has led to investigations into the efficacy of recombinant Tnfrsf10b as an anti-cancer agent and its potential use in combination therapies to overcome resistance mechanisms. Furthermore, the safety and efficacy of Tnfrsf10b-based therapeutics are being evaluated in preclinical and clinical trials, emphasizing its role in advancing cancer treatment strategies. The growing body of research seeks to understand the structural and functional dynamics of DR5, paving the way for the development of innovative solutions in oncology.
