Analytical Data
-
Gene name
SENP2
- Application
-
Alternative Names
SENP2;KIAA1331;Sentrin-specific protease 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HC62
-
Expression Region
360-589aa
-
AA Sequence
RRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYH WLNDEVINFYMNLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTK GVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILL QYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYADYI SRDKPITFTQHQMPLFRKKMVWEILHQQLL
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SENP2, or SUMO-specific protease 2, is an essential enzyme that plays a critical role in the post-translational modification process known as SUMOylation. This process involves the attachment of Small Ubiquitin-like Modifier (SUMO) proteins to target proteins, thereby influencing their function, localization, and stability. Dysregulation of SUMOylation has been implicated in various pathological conditions, including cancer, neurodegenerative diseases, and developmental disorders. Given its pivotal function in cellular processes, such as gene expression, stress response, and cell cycle regulation, SENP2 has emerged as a significant research focus. The study of SENP2, particularly its recombinant protein, provides insights into its enzymatic activity and regulatory mechanisms. Understanding how SENP2 modulates SUMOylation can reveal potential therapeutic targets for diseases associated with SUMO pathway dysregulation. Recent advances in recombinant DNA technology and protein purification methods have facilitated the production of highly pure SENP2 proteins, enabling researchers to perform detailed biochemical and structural analyses. Investigating SENP2's interactions with SUMO conjugates and other cellular proteins can uncover its role within the SUMO signaling network and its implications for cell biology. Consequently, research on SENP2 recombinant protein stands at the forefront of understanding SUMOylation dynamics and its impact on health and disease, paving the way for innovative therapeutic strategies.











