Cat: PA2000-5734

Recombinant Human B3GALT6 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B3GALT6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    B3GALT6; Beta-1.3-galactosyltransferase 6; Beta-1.3-GalTase 6; Beta3Gal-T6; Beta3GalT6

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96L58

  • Expression Region

    229-329aa

  • AA Sequence

    RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP

  • Molecular Weight

    36.85 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B3GALT6, or Beta-1,3-Galactosyltransferase 6, is an enzyme that plays a crucial role in glycosylation processes, specifically in the synthesis of glycosaminoglycans and proteoglycans. These molecules are essential for various physiological functions, including cell signaling, tissue hydration, and the structural integrity of the extracellular matrix. Mutations in the B3GALT6 gene have been associated with several genetic disorders, particularly those affecting skeletal development, such as spondyloepiphyseal dysplasia and other skeletal dysplasias. Research on B3GALT6 recombinant proteins is vital for understanding the enzyme's biological functions and the molecular mechanisms underlying these congenital conditions. By producing and characterizing recombinant B3GALT6, scientists aim to elucidate its glycosyltransferase activity, substrate specificity, and interactions with other proteins in the glycosylation pathway. This research not only contributes to the basic understanding of glycosylation mechanisms but also holds potential therapeutic implications. By understanding how B3GALT6 mutations lead to disease, researchers may develop targeted gene therapies or small molecule drugs that can correct or compensate for the dysfunctional enzyme activity. Overall, the study of B3GALT6 recombinant proteins is an important area of biomedical research with significant implications for genetics, developmental biology, and therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US