Analytical Data
-
Gene name
B3GALT6
- Application
-
Alternative Names
B3GALT6; Beta-1.3-galactosyltransferase 6; Beta-1.3-GalTase 6; Beta3Gal-T6; Beta3GalT6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96L58
-
Expression Region
229-329aa
-
AA Sequence
RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP
-
Molecular Weight
36.85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B3GALT6, or Beta-1,3-Galactosyltransferase 6, is an enzyme that plays a crucial role in glycosylation processes, specifically in the synthesis of glycosaminoglycans and proteoglycans. These molecules are essential for various physiological functions, including cell signaling, tissue hydration, and the structural integrity of the extracellular matrix. Mutations in the B3GALT6 gene have been associated with several genetic disorders, particularly those affecting skeletal development, such as spondyloepiphyseal dysplasia and other skeletal dysplasias. Research on B3GALT6 recombinant proteins is vital for understanding the enzyme's biological functions and the molecular mechanisms underlying these congenital conditions. By producing and characterizing recombinant B3GALT6, scientists aim to elucidate its glycosyltransferase activity, substrate specificity, and interactions with other proteins in the glycosylation pathway. This research not only contributes to the basic understanding of glycosylation mechanisms but also holds potential therapeutic implications. By understanding how B3GALT6 mutations lead to disease, researchers may develop targeted gene therapies or small molecule drugs that can correct or compensate for the dysfunctional enzyme activity. Overall, the study of B3GALT6 recombinant proteins is an important area of biomedical research with significant implications for genetics, developmental biology, and therapeutic interventions.











