Analytical Data
-
Gene name
PHF17
- Application
-
Alternative Names
FLJ22479; Gene for apoptosis and differentiation in epithelia; Jade family PHD finger 1; JADE1 ; JADE1_HUMAN; KIAA1807 ; OTTHUMP00000219842; OTTHUMP00000219934; OTTHUMP00000219935; OTTHUMP00000219936; PHD finger protein 17; PHD protein Jade 1; Phf17; Protein Jade 1; Protein Jade-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IE81
-
Expression Region
1-509 aa
-
AA Sequence
MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLERVMIDTDTL
-
Molecular Weight
81.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PHF17 (PHD finger protein 17) is a member of the PHD (Plant Homeodomain) finger protein family, which is known for its critical roles in epigenetic regulation and chromatin remodeling. It has been implicated in various biological processes, including gene expression, cell differentiation, and DNA repair. The study of PHF17 is particularly important due to its potential involvement in developmental disorders and various cancers, where its dysregulation can lead to abnormal cell proliferation and survival. Recent research has focused on the structural characterization of PHF17, as understanding its three-dimensional conformation is essential for elucidating its functional mechanisms and interactions with other proteins. Recombining PHF17 into a soluble form allows for detailed biochemical studies, including its binding affinities, post-translational modifications, and roles in transcriptional regulation. The development of PHF17 recombinant protein also paves the way for high-throughput screening assays and drug discovery efforts targeting its pathways. Overall, the investigation of PHF17 recombinant protein not only enhances our understanding of its basic biological functions but also contributes to the identification of novel therapeutic strategies for diseases linked to its aberrant activity.
