Analytical Data
-
Gene name
VSTM2L
- Application
-
Alternative Names
VSTM2L;C20orf102;V-set and transmembrane domain-containing Protein 2-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96N03
-
Expression Region
25-204aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMTRPAGHAPWDNHVSGHALFTETPHD MTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLK ASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSD GKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQ EACSL
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSTM2L, or V-set and transmembrane domain-containing 2-like protein, has garnered attention in recent years due to its potential roles in immune regulation and cell signaling. Researchers have identified VSTM2L as a member of the V-set immunoglobulin superfamily, which is known for its involvement in various biological processes, including cell adhesion, recognition, and immune responses. Initial studies suggest that VSTM2L may play a role in modulating inflammatory responses and could be implicated in the pathogenesis of autoimmune diseases. The protein's expression patterns, particularly in immune cells, hint at its significance in maintaining immune homeostasis. However, the functional mechanisms underlying VSTM2L's actions remain largely unexplored, leading to a growing interest in delineating its structure, function, and potential therapeutic applications. The recombinant production of VSTM2L protein will enable further investigation into its biological functions, interactions with other molecules, and potential as a biomarker or therapeutic target. Understanding VSTM2L's role in the immune system could pave the way for novel strategies in treating inflammatory diseases and enhancing immune responses in clinical settings. As such, research into VSTM2L and its recombinant protein forms is essential for advancing our knowledge of immune regulation and developing innovative therapeutic approaches.











