Cat: PA1000-3461

Recombinant Human VEGFC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VEGFC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VEGFC;Vascular endothelial growth factor C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49767

  • Expression Region

    112-227aa

  • AA Sequence

    AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYR CGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRC MSKLDVYRQVHSIIRR

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VEGFC (Vascular Endothelial Growth Factor C) is a key protein in the VEGF family, primarily involved in lymphangiogenesis, the formation of lymphatic vessels, and angiogenesis, the formation of blood vessels. Its significance has been highlighted in numerous studies linking VEGFC to both normal physiological processes and various pathological conditions, including cancer, cardiovascular diseases, and lymphedema. In cancer, VEGFC has been implicated in promoting tumor metastasis by enhancing lymphatic vessel development, thereby facilitating the spread of cancer cells. Research on VEGFC recombinant proteins has gained momentum as it offers the potential to understand its biological functions in greater detail and develop therapeutic interventions. By producing VEGFC as a recombinant protein, researchers can investigate its structure, signaling pathways, and interactions with receptors such as VEGFR-3. Additionally, studying VEGFC in a controlled environment helps unravel its role in the vascular system and its implications in disease progression. The development of VEGFC-based therapies, encompassing either inhibition of its action to combat tumor growth or stimulation to promote wound healing and tissue regeneration, underscores the protein's dual potential as both a therapeutic target and a treatment agent. Thus, the study of recombinant VEGFC is an important facet of modern biomedical research, providing insights that could lead to novel strategies in treating diseases associated with vascular dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US