Analytical Data
-
Gene name
HOMG2
- Application
-
Alternative Names
HOMG2；ATP1C；ATP1G1；Sodium/potassium-transporting ATPase subunit gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B1H356
-
Expression Region
1-61aa
-
AA Sequence
MADAQDDMSQMQDKFTYDYETVRKGGLIFAAIAFVVGMLIIFSGRFRCGRKKQLRALNEDM
-
Molecular Weight
6.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HOMG2, or Homeobox protein Hox-G2, is a member of the homeobox gene family that plays a crucial role in regulating embryonic development and cellular differentiation. Research into HOMG2 recombinant proteins has intensified due to its significant involvement in developmental processes and potential implications in various diseases, including cancers and genetic disorders. Understanding the structure and function of HOMG2 at a molecular level can provide insights into its mechanisms of action and regulatory pathways. The production of HOMG2 recombinant proteins allows for the study of its interactions with other proteins and DNA, facilitating the exploration of its role in transcriptional regulation. Advances in techniques such as gene cloning and expression systems have enabled scientists to produce these proteins in adequate quantities for detailed functional assays, which are critical for unraveling the complexities of developmental biology. Moreover, the potential therapeutic applications of HOMG2, including gene therapy and regenerative medicine, further underscore the importance of this research. As scientists continue to characterize the biological activities of HOMG2, its role in normal physiology and pathological conditions will be better understood, paving the way for novel therapeutic strategies targeting homeobox gene functions.
