Analytical Data
-
Gene name
ATP11C
- Application
-
Alternative Names
AT11C_HUMAN; ATP11C; ATPase class VI type 11C; ATPase IG; ATPase IQ; ATPIG
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NB49
-
Expression Region
441-545aa
-
AA Sequence
VDGLSQTDGTLTYFDKVDKNREELFLRALCLCHTVEIKTNDAVDGATESAELTYISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFDA
-
Molecular Weight
37.29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ATP11C recombinant protein has gained significant attention in recent years due to its pivotal role in cellular processes, particularly in the context of immune response and cellular ion homeostasis. ATP11C, a member of the P-type ATPase family, is primarily expressed in hematopoietic tissues and is crucial for maintaining the lipid asymmetry of the plasma membrane. Dysregulation of ATP11C function has been implicated in various immunological disorders, affecting T cell development and function. Furthermore, research has shown that ATP11C contributes to the transport of phospholipids, which are essential for membrane integrity and signaling. Given its critical functions, recombinant ATP11C protein is being explored as a potential therapeutic target for autoimmune diseases and cancers where its expression and function may be altered. Advanced techniques in recombinant protein expression help elucidate the structural and functional properties of ATP11C, providing insights into its mechanistic roles within the cell. Researchers are particularly interested in producing and characterizing ATP11C recombinant protein to develop specific inhibitors or modulators that could offer novel avenues for treatment. Moreover, studying ATP11C may also shed light on fundamental biological mechanisms governing membrane dynamics and cellular communication, thus further enhancing our understanding of both normal physiology and pathological conditions. Overall, ATP11C serves as a promising candidate for further investigation, with potential implications for therapeutic intervention in diseases associated with immune dysregulation and cellular dysfunction.
