Analytical Data
-
Gene name
URM1
- Application
-
Alternative Names
URM1；C9orf74；Ubiquitin-related modifier 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BTM9
-
Expression Region
1-101aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLP GQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLG ELDYQLQDQDSVLFISTLHGG
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
URM1 (Ubiquitin-Related Modifier 1) is a small ubiquitin-like protein that plays a pivotal role in various cellular processes, including protein degradation, stress response, and protein homeostasis. The study of URM1 has gained traction due to its involvement in the ubiquitin-proteasome system and its potential implications in human diseases, such as cancer and neurodegenerative disorders. URM1 is known to conjugate to target proteins, thereby influencing their stability and function. Researchers have identified that URM1 can modify proteins in a manner similar to ubiquitin, albeit with unique characteristics that differentiate it from traditional ubiquitination pathways. The exploration of URM1's structure, function, and interaction networks is crucial for understanding its biological significance and therapeutic potential. Continued investigation into URM1 may unravel novel molecular mechanisms underlying cellular regulation and open up new avenues for drug development. Furthermore, the study of URM1 serves as a model for understanding the broader family of ubiquitin-like modifiers, highlighting the complexity of post-translational modifications and their critical roles in cell biology.
