Analytical Data
-
Gene name
NANP
- Application
-
Alternative Names
NANP；Homeobox Protein NANOGP8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBE9
-
Expression Region
1-248aa
-
AA Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGS MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICD KVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLW KSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSY FDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLN AGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NANP, a peptide derived from the circumsporozoite protein of Plasmodium falciparum, has garnered significant attention in malaria vaccine research due to its role in the parasite's lifecycle and its immunogenic potential. The World Health Organization continues to spotlight malaria as a major global health challenge, necessitating the development of effective vaccines to reduce morbidity and mortality associated with this disease. The NANP repeat region is highly conserved and elicits strong immune responses, making it an attractive target for vaccine development. Recent studies have focused on the engineering of NANP as a recombinant protein, aiming to enhance its immunogenicity through various adjuvant strategies and delivery systems. The successful expression of NANP in heterologous systems, along with optimization strategies to improve its stability and efficacy, underscores its potential as a key component in malaria vaccines. As researchers explore the mechanisms by which NANP elicits protective immunity, advancements in its formulation may contribute to the development of a safe and effective malaria vaccine, ultimately paving the way for groundbreaking approaches to malaria prevention and control.
