Analytical Data
-
Gene name
APG3L
- Application
-
Alternative Names
APG3-like; APG3L; Apg3p; ATG 3; ATG3; ATG3 autophagy related 3 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NT62
-
Expression Region
1-314aa
-
AA Sequence
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
-
Molecular Weight
51.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APG3L (autophagy-related 3-like) is a crucial gene involved in the regulation of autophagy, a cellular process responsible for the degradation and recycling of components, essential for maintaining cellular homeostasis and responding to stress. Research into APG3L has gained prominence due to its implications in various diseases, including neurodegenerative disorders and cancer, where dysregulation of autophagy is often observed. The protein encoded by this gene is part of the cysteine protease family, contributing to the enzymatic activities that facilitate the autophagic pathway. Understanding the structure and function of APG3L is vital for deciphering its role in cellular processes and its potential therapeutic applications. Recent studies have focused on the recombinant production of APG3L, enabling researchers to investigate its biophysical properties, enzymatic function, and interactions with other autophagy-related proteins. This research is critical to elucidate the molecular mechanisms by which APG3L influences autophagy and its broader impact on health and disease, potentially guiding the development of targeted treatments that harness autophagy modulation. As scientists continue to explore the significance of APG3L, its recombinant protein serves as a valuable tool in dissecting the complexities of cellular degradation pathways and their relevance in pathophysiological contexts.
