Analytical Data
-
Gene name
MTZ
- Application
-
Alternative Names
MTZ;Deazaflavin-dependent nitroreductase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WP15
-
Expression Region
1-151aa
-
AA Sequence
MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP
-
Molecular Weight
17.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on MTZ (Methotrexate Resistance Protein) recombinant proteins has gained significant traction in the field of molecular biology and pharmacology due to their implications in cancer treatment and drug resistance. MTZ proteins are involved in the transport and metabolism of methotrexate, a widely used chemotherapeutic agent that inhibits cancer cell proliferation by targeting folate metabolism. However, the emergence of drug resistance is a major challenge in cancer therapy, often leading to treatment failure. Understanding the structure and function of MTZ proteins is essential for elucidating the mechanisms behind resistance. Researchers are utilizing recombinant DNA technology to produce and characterize these proteins, enabling them to study their interactions with methotrexate at a molecular level. This knowledge can potentially lead to the development of new therapeutic strategies aimed at overcoming drug resistance, optimizing the efficacy of methotrexate, and enhancing patient outcomes. Additionally, insights gained from crafting MTZ recombinant proteins may facilitate the identification of biomarkers for predicting treatment responses and the discovery of novel compounds that can circumvent resistance pathways. Overall, the investigation into MTZ recombinant proteins represents a critical step towards understanding and improving cancer therapeutics, with the potential for substantial clinical impact.











