Analytical Data
-
Gene name
OR6C3
- Application
-
Alternative Names
OR6C3; Olfactory receptor 6C3; HSA8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZP0
-
Expression Region
1-311 aa
-
AA Sequence
MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFL RNFSFLEISFTTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRY VAICKPLHYTSIMNRKLCTLLVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFP LLQLSCSDTWLLEVIGFYFALVTLLFTLALVILSYMYIIRTILRIPSASQRKKAFSTCSS HMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAPMLNPFIYTLRNQQVKQAFKN VVHKVVFYANQ
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR6C3 is a member of the olfactory receptor family, specifically classified under the class of G-protein coupled receptors (GPCRs). These receptors are primarily responsible for the detection of odors and are crucial for the sensory perception of smell in many species, including humans. The study of OR6C3 has garnered interest due to its potential implications in understanding olfactory mechanisms and neurological processes linked to scent perception. Research has shown that olfactory receptors like OR6C3 may not only play roles in sensory functions but could also be involved in various physiological and pathological conditions, including neurodegenerative diseases and mental health disorders. The recombinant production of OR6C3 protein allows for in-depth functional assays and structure-function analyses, facilitating insights into its ligand binding properties and signaling pathways. This research may enhance our comprehension of the broader olfactory receptor system and its contributions to human behavior and health, making OR6C3 an important target for both basic research and potential therapeutic innovations. By elucidating the characteristics and functionalities of this receptor, scientists can explore avenues for developing interventions aimed at modulating olfactory signaling and addressing related health challenges.
