Analytical Data
-
Gene name
OR5P3
- Application
-
Alternative Names
OR5P3; Olfactory receptor 5P3; Olfactory receptor OR11-94; Olfactory receptor-like protein JCG1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WZ94
-
Expression Region
1-311 aa
-
AA Sequence
MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAY DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD YSPLLKLACSHDFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGA LKRELRIKIFS
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR5P3 protein, a member of the olfactory receptor (OR) family, plays a crucial role in the detection of specific odorant molecules, making it a subject of interest in the fields of sensory biology and neuroscience. Olfactory receptors are a large and diverse group of G protein-coupled receptors that mediate the sense of smell by binding to volatile compounds. The study of OR5P3 is particularly relevant due to its unique ligand specificity and potential implications in understanding olfactory signaling mechanisms. Research has shown that variations in the expression and functionality of olfactory receptors, including OR5P3, can be linked to individual differences in odor perception and preferences. Moreover, the study of this receptor may offer insights into the evolution of olfactory systems across different species. Given its significance, efforts to characterize and produce recombinant OR5P3 protein have been undertaken to explore its structure, functional properties, and interactions with odorants. Such studies could pave the way for developing novel applications in scent technology, flavor enhancement in food industries, and even contribute to advancements in biomarker discovery for olfactory-related disorders. By elucidating the functional dynamics of OR5P3, researchers aim to deepen our understanding of olfactory processes and their broader impacts on behavior and ecology.
