Analytical Data
-
Gene name
OR4N5
- Application
-
Alternative Names
OR4N5; Olfactory receptor 4N5; Olfactory receptor OR14-33
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXE1
-
Expression Region
1-308 aa
-
AA Sequence
METQNLTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFLIIFTIKSDPGLTAPLY FFLGNLALLDASYSFIVVPRMLVDFLSEKKVISYRSCITQLFFLHFLGAGEMFLLVVMAF DRYIAICRPLHYSTIMNPRACYALSLVLWLGGFIHSIVQVALILHLPFCGPNQLDNFFCD VPQVIKLACTNTFVVELLMVSNSGLLSLLCFLGLLASYAVILCRIREHSSEGKSKAISTC TTHIIIIFLMFGPAIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRK LLSQHMFC
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4N5 is a member of the olfactory receptor gene family, which plays a crucial role in the detection of specific odorant molecules. The study of OR4N5 and its recombinant protein is essential for understanding the mechanisms of olfaction, as olfactory receptors are involved in the transduction of chemical signals into neural responses. Research suggests that OR4N5 may have specific functional roles in odor recognition and discrimination, potentially influencing behaviors such as food choice and predator detection. In recent years, advances in recombinant DNA technology have allowed researchers to express OR4N5 in heterologous systems, facilitating the purification and functional characterization of the protein. This research is significant not only for elucidating the molecular basis of smell but also for exploring its implications in broader biological and neurological contexts. By investigating the structure-function relationship of OR4N5, scientists aim to uncover insights into how olfactory receptors interact with odorants and contribute to sensory perception. Additionally, studies on OR4N5 may have potential applications in the development of new aroma compounds or in the field of artificial olfaction, highlighting the importance of this receptor in both fundamental and applied research. Understanding the behavior and properties of OR4N5 could ultimately lead to advancements in sensory biology and enhance applications in industries such as flavor, fragrance, and health.
