Analytical Data
-
Gene name
OR4N2
- Application
-
Alternative Names
OR4N2; Olfactory receptor 4N2; Olfactory receptor OR14-13; Olfactory receptor OR14-8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGD1
-
Expression Region
1-307 aa
-
AA Sequence
MESENRTVIREFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIKSDPGLTAPLY FFLGNLAFLDASYSFIVAPRMLVDFLSAKKIISYRGCITQLFFLHFLGGGEGLLLVVMAF DRYIAICRPLHYPTVMNPRTCYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRIRGSSSEAKNKAMSTC ITHIIVIFFMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKK VFNKHIA
-
Molecular Weight
34.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4N2 is a member of the olfactory receptor family, which plays a crucial role in the sensory system by detecting volatile compounds and contributing to the sense of smell. Recent research has highlighted the significance of olfactory receptors beyond olfaction, suggesting an involvement in various physiological processes and potential implications for therapeutic applications. OR4N2, in particular, has garnered attention due to its specific expression patterns and potential roles in different tissues. Investigating the recombinant expression of OR4N2 can provide insights into its structure-function relationships, and could enable biophysical characterization and ligand-binding studies. Moreover, understanding the signaling pathways and biological mechanisms linked to OR4N2 may pave the way for innovative approaches in drug discovery and personalized medicine, ultimately enhancing our comprehension of olfactory biology and its relevance in health and disease. Given the complexity of receptor-ligand interactions and the challenges in studying membrane proteins, the development of OR4N2 as a recombinant protein offers valuable opportunities for elucidating its functional properties and therapeutic potentials.
