Analytical Data
-
Gene name
OR4K2
- Application
-
Alternative Names
OR4K2; Olfactory receptor 4K2; Olfactory receptor OR14-15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGD2
-
Expression Region
1-314 aa
-
AA Sequence
MDVGNKSTMSEFVLLGLSNSWELQMFFFMVFSLLYVATMVGNSLIVITVIVDPHLHSPMY FLLTNLSIIDMSLASFATPKMITDYLTGHKTISFDGCLTQIFFLHLFTGTEIILLMAMSF DRYIAICKPLHYASVISPQVCVALVVASWIMGVMHSMSQVIFALTLPFCGPYEVDSFFCD LPVVFQLACVDTYVLGLFMISTSGIIALSCFIVLFNSYVIVLVTVKHHSSRGSSKALSTC TAHFIVVFLFFGPCIFIYMWPLSSFLTDKILSVFYTIFTPTLNPIIYTLRNQEVKIAMRK LKNRFLNFNKAMPS
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR4K2 protein, a member of the olfactory receptor (OR) family, is primarily expressed in the human nasal epithelium and plays a crucial role in the sense of smell. Research into OR4K2 has gained attention due to its involvement in olfactory signal transduction pathways, which affect both odor detection and neural communication. Understanding the structure and function of OR4K2 can provide insights into the complexities of olfactory signaling and its implications for human behavior and physiology. Additionally, given the increasing prevalence of olfactory disorders, studies on OR4K2 and other olfactory receptors have the potential to inform therapeutic strategies for conditions affecting the sense of smell. Investigations into the recombinant expression of OR4K2 facilitate the exploration of its ligand specificity and molecular mechanisms, thus enhancing our comprehension of olfactory receptor functions. Overall, the study of OR4K2 not only contributes to the fundamental understanding of sensory biology but also opens avenues for innovative approaches in treating olfactory-related dysfunctions.
