Analytical Data
-
Gene name
OR4K1
- Application
-
Alternative Names
OR4K1; Olfactory receptor 4K1; Olfactory receptor OR14-19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGD4
-
Expression Region
1-311 aa
-
AA Sequence
MAHTNESMVSEFVLLGLSNSWGLQLFFFAIFSIVYVTSVLGNVLIIVIISFDSHLNSPMY FLLSNLSFIDICQSNFATPKMLVDFFIERKTISFEGCMAQIFVLHSFVGSEMMLLVAMAY DRFIAICKPLHYSTIMNRRLCVIFVSISWAVGVLHSVSHLAFTVDLPFCGPNEVDSFFCD LPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYTIILIGVRCRSSSGSSKALSTL TAHITVVILFFGPCIYFYIWPFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWK LRNRHVNSWKN
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR4K1 is a member of the olfactory receptor (OR) family, which is crucial for the sense of smell. As a G-protein coupled receptor, OR4K1 plays a vital role in the detection of odorants, facilitating the conversion of chemical signals into neural responses in the olfactory system. Research on OR4K1 is significant due to its implications in understanding not only the mechanisms of olfaction but also the genetic and neurological basis of various sensory processes. The study of OR4K1 and its interactions with specific ligands may unravel novel insights into olfactory signal transduction pathways and could lead to broader applications in the fields of biotechnology and pharmacology. Given the diversity of olfactory receptors and their roles in human health, insights from OR4K1 research could also be valuable in the context of diseases linked to olfactory dysfunction, enhancing our understanding of conditions like anosmia or other neurodegenerative disorders. Moreover, exploring the recombinant protein expression of OR4K1 could aid in the development of biosensors or therapeutic agents that target the olfactory system, thus exemplifying the importance of this research in both basic and applied sciences.
