Analytical Data
-
Gene name
AK3L1
- Application
-
Alternative Names
AK 3; AK3; AK3. formerly; AK3L1; AK4; AK4. mouse. homolog of; AK6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIJ7
-
Expression Region
1-227aa
-
AA Sequence
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
-
Molecular Weight
50.27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AK3L1, or Adenylate Kinase 3-Like 1, is a member of the adenylate kinase family, playing a critical role in cellular energy homeostasis by catalyzing the conversion of ADP to ATP and AMP. This enzyme is essential in maintaining the balance of adenine nucleotides, which is crucial for numerous cellular functions, including metabolism, signal transduction, and cellular stress responses. Research into AK3L1 is gaining momentum due to its potential implications in various diseases, including cancer and metabolic disorders. Altered expression or activity of AK3L1 has been associated with abnormal cell proliferation and survival, prompting investigations into its role as a therapeutic target. Furthermore, the recombinant expression of AK3L1 facilitates a deeper understanding of its biochemical properties and interactions with other cellular components, making it a valuable tool for elucidating its function in physiological and pathological contexts. Recent studies have also explored the protein's role in mitochondrial dynamics and its influence on apoptosis, highlighting its significance in both energy metabolism and cell fate regulation. Understanding AK3L1's mechanisms and pathways could pave the way for novel interventions in diseases characterized by cellular energy dysregulation. As such, the recombinant protein study of AK3L1 is crucial in advancing our knowledge of cellular energy management and its broader implications in health and disease.
