Analytical Data
-
Gene name
OR2W1
- Application
-
Alternative Names
OR2W1; Olfactory receptor 2W1; Hs6M1-15; Olfactory receptor OR6-13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3N9
-
Expression Region
1-320 aa
-
AA Sequence
MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMY FFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSY DRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCE LPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMNT CGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKDMKDA LKKLMRFHHKSTKIKRNCKS
-
Molecular Weight
36.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OR2W3, a member of the olfactory receptor family, is a G protein-coupled receptor (GPCR) primarily expressed in the olfactory epithelium, where it plays a crucial role in odor detection. Recent studies have shown that OR2W3 is involved in the perception of various environmental odors, which can influence behavioral responses in animals. The interest in OR2W3 extends beyond sensory biology; its unique structure and signaling mechanisms present potential therapeutic targets for disorders linked to olfactory dysfunction. Additionally, research has indicated that this receptor may play roles in various physiological processes, including those related to the immune system and cell signaling. The development of recombinant OR2W3 proteins facilitates in-depth investigation into its molecular function and interaction with specific ligands. This research not only enhances our understanding of olfactory signaling pathways but also opens avenues for biotechnological applications, including the design of novel odorants and aroma compounds. Given the growing realization of olfactory receptors in various non-sensory contexts, the study of OR2W3 and related receptors is poised to contribute significantly to the fields of neuroscience, pharmacology, and bioengineering.
