Cat: PA2000-1285

Recombinant Human C4d Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C4d

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C4d;CO4;CPAMD2;Complement C4-A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0C0L4

  • Expression Region

    957-1336aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSY VRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRY LDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTW LTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRS MQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANS FLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDN LYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEG KAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGL NVTLSSTGR

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C4d, a specific fragment of complement component 4 (C4), is recognized as a significant biomarker in the context of immune-mediated diseases and organ transplantation. Its formation is an indicator of complement activation, particularly in conditions where the immune system is dysregulated. The study of C4d has gained momentum due to its crucial role in diagnosing and monitoring transplant rejection, especially in kidney and heart transplants. Elevated levels of C4d in the tissue of transplanted organs correlate with antibody-mediated rejection, providing insights into the underlying mechanisms of graft dysfunction. Moreover, C4d is being investigated as a potential therapeutic target, with research focusing on strategies to modulate complement activation to improve transplant outcomes and manage various autoimmune diseases. By understanding the biochemical pathways and physiological implications of C4d accumulation, researchers hope to develop innovative approaches for enhancing graft survival and reducing the incidence of rejection episodes. This growing body of research underscores the importance of C4d not just as a biomarker but also as a pivotal player in the intricate interplay between the immune system and transplant biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US