Analytical Data
-
Gene name
OR11H6
- Application
-
Alternative Names
OR11H6; Olfactory receptor 11H6; Olfactory receptor OR14-35
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NGC7
-
Expression Region
1-330 aa
-
AA Sequence
MFFIIHSLVTSVFLTALGPQNRTMHFVTEFVLLGFHGQREMQSCFFSFILVLYLLTLLGN GAIVCAVKLDRRLHTPMYILLGNFAFLEIWYISSTVPNMLVNILSEIKTISFSGCFLQFY FFFSLGTTECFFLSVMAYDRYLAICRPLHYPSIMTGKFCIILVCVCWVGGFLCYPVPIVL ISQLPFCGPNIIDHLVCDPGPLFALACISAPSTELICYTFNSMIIFGPFLSILGSYTLVI RAVLCIPSGAGRTKAFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPAGMQKIITLVYTAMT PFLNPLIYSLRNKDMKDALKRVLGLTVSQN
-
Molecular Weight
36.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR11H6 gene, part of the olfactory receptor family, encodes a protein that plays a crucial role in the detection of odorants in the nasal epithelium. These receptors are G protein-coupled receptors (GPCRs) that initiate a signal transduction pathway upon binding with specific ligands, contributing to the sense of smell. Research into OR11H6 has gained prominence not only due to its fundamental role in olfactory perception but also due to its potential implications in understanding human behavioral responses to various scents. Recent studies have suggested that variations in olfactory receptor expression might influence individual differences in fragrance perception and choice. Additionally, the exploration of OR11H6 could shed light on evolutionary adaptations in olfactory systems across species. The recombinant protein derived from OR11H6 provides a valuable tool for biochemical characterization and functional assays, facilitating the identification of its ligands and elucidating its signaling mechanisms. This research could lead to advancements in fields such as perfumery, food science, and even therapeutic applications targeting olfactory-related disorders. Furthermore, understanding OR11H6’s role might contribute to broader insights into the intricate interplay between olfaction and other sensory systems, thus enhancing our grasp of sensory biology as a whole. Overall, the study of the OR11H6 recombinant protein represents a promising frontier in the intersection of molecular biology, neuroscience, and sensory studies, holding potential for innovative applications in both basic research and applied sciences.











