Cat: PA2000-9873

Recombinant Human OR11H6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OR11H6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OR11H6; Olfactory receptor 11H6; Olfactory receptor OR14-35

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NGC7

  • Expression Region

    1-330 aa

  • AA Sequence

    MFFIIHSLVTSVFLTALGPQNRTMHFVTEFVLLGFHGQREMQSCFFSFILVLYLLTLLGN GAIVCAVKLDRRLHTPMYILLGNFAFLEIWYISSTVPNMLVNILSEIKTISFSGCFLQFY FFFSLGTTECFFLSVMAYDRYLAICRPLHYPSIMTGKFCIILVCVCWVGGFLCYPVPIVL ISQLPFCGPNIIDHLVCDPGPLFALACISAPSTELICYTFNSMIIFGPFLSILGSYTLVI RAVLCIPSGAGRTKAFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPAGMQKIITLVYTAMT PFLNPLIYSLRNKDMKDALKRVLGLTVSQN

  • Molecular Weight

    36.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The OR11H6 gene, part of the olfactory receptor family, encodes a protein that plays a crucial role in the detection of odorants in the nasal epithelium. These receptors are G protein-coupled receptors (GPCRs) that initiate a signal transduction pathway upon binding with specific ligands, contributing to the sense of smell. Research into OR11H6 has gained prominence not only due to its fundamental role in olfactory perception but also due to its potential implications in understanding human behavioral responses to various scents. Recent studies have suggested that variations in olfactory receptor expression might influence individual differences in fragrance perception and choice. Additionally, the exploration of OR11H6 could shed light on evolutionary adaptations in olfactory systems across species. The recombinant protein derived from OR11H6 provides a valuable tool for biochemical characterization and functional assays, facilitating the identification of its ligands and elucidating its signaling mechanisms. This research could lead to advancements in fields such as perfumery, food science, and even therapeutic applications targeting olfactory-related disorders. Furthermore, understanding OR11H6’s role might contribute to broader insights into the intricate interplay between olfaction and other sensory systems, thus enhancing our grasp of sensory biology as a whole. Overall, the study of the OR11H6 recombinant protein represents a promising frontier in the intersection of molecular biology, neuroscience, and sensory studies, holding potential for innovative applications in both basic research and applied sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US