Analytical Data
-
Gene name
AP2s1
- Application
-
Alternative Names
AP2s1；AP17；CLAPS2；AP-2 complex subunit sigma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53680
-
Expression Region
1-142aa
-
AA Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
-
Molecular Weight
23.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AP2S1, a gene encoding the adaptor protein AP-2 sigma, has garnered significant attention in recent years due to its critical role in clathrin-mediated endocytosis and intracellular trafficking. As a key component of the AP-2 complex, AP2S1 facilitates the recognition of specific cargo proteins and their subsequent internalization into cells, which is essential for various cellular processes, including signal transduction, nutrient uptake, and receptor recycling. Dysregulation of AP2S1 has been linked to several pathologies, including cancer, metabolic disorders, and neurodegenerative diseases, prompting researchers to investigate its functional mechanisms. Studies have demonstrated that mutations in AP2S1 can disrupt its interaction with cargo proteins, leading to impaired endocytic pathways and contributing to disease progression. Moreover, understanding AP2S1's structure and interaction with other proteins may provide insights into potential therapeutic targets for modulating endocytosis-related disorders. The ongoing exploration of AP2S1 recombinant proteins enhances our understanding of its biological functions and paves the way for innovative treatments aimed at restoring normal cellular trafficking and function. As such, AP2S1 stands out as a promising candidate for further research within the fields of cell biology and molecular medicine, highlighting the importance of understanding this protein's roles in health and disease.
