Analytical Data
-
Gene name
SLAMF1
- Application
-
Alternative Names
SLAMF1;SLAM;Signaling lymphocytic activation molecule
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13291
-
Expression Region
21-237aa
-
AA Sequence
ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGD HVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQ TFSPWPGCRTDPSETKPVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLAMF1 (Signaling Lymphocytic Activation Molecule Family Member 1), also known as CD352, is a transmembrane protein primarily expressed on the surface of activated immune cells, including T lymphocytes and natural killer (NK) cells. Research has indicated that SLAMF1 plays a critical role in modulating immune responses, influencing cytokine production and cellular proliferation. Given its involvement in immune regulation, SLAMF1 has drawn attention as a potential target for therapeutic interventions in autoimmune diseases, infections, and cancer. The generation of recombinant SLAMF1 protein is essential for elucidating its functional roles and interactions in various biological contexts. Such recombinant proteins can be used in biochemical assays to analyze binding interactions, signaling pathways, and to explore the molecular mechanisms underlying its immunological functions. Furthermore, the study of SLAMF1 could lead to novel insights into immune system dynamics and may facilitate the development of targeted therapies that leverage SLAMF1's role in immune modulation. As research progresses, understanding the structure and function of SLAMF1 through recombinant technology may open doors for its application in clinical settings, highlighting its significance in the field of immunology and therapeutic design.
