Analytical Data
-
Gene name
SFRP4
- Application
-
Alternative Names
SFRP4;FRPHE;Secreted frizzled-related Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6FHJ7
-
Expression Region
19-346aa
-
AA Sequence
VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVN CSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHS WPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDV DCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVV DVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLL ENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKG KPPAPKPASPKKNIKTRSAQKRTNPKRV
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFRP4 (Secreted Frizzled-Related Protein 4) is a member of the SFRP family that plays a crucial role in the regulation of the Wnt signaling pathway, which is essential for various cellular processes including development, differentiation, and cell proliferation. Dysregulation of Wnt signaling has been implicated in numerous pathological conditions, such as cancer, diabetes, and neurodegenerative diseases, making SFRP4 an important molecule for research. Studies have shown that SFRP4 functions as an antagonist of the Wnt pathway by binding to Wnt ligands and preventing their interaction with Frizzled receptors. Furthermore, SFRP4 is known to be involved in various biological processes, such as organogenesis, tissue homeostasis, and stem cell regulation. Recent research has indicated its potential role in tumor suppression and modulation of the tumor microenvironment, enhancing interest in SFRP4 as a therapeutic target. As a result, recombinant SFRP4 proteins have been developed for various experimental applications to elucidate the molecular mechanisms underlying its function and to explore its potential in novel cancer therapies. Understanding the effects of SFRP4 through recombinant protein experiments could provide insights into its therapeutic implications and lead to new strategies for targeting Wnt-related diseases.
