Analytical Data
-
Gene name
SFRP2
- Application
-
Alternative Names
SFRP2;FRP2;SARP1;Secreted frizzled-related Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96HF1
-
Expression Region
68-186aa
-
AA Sequence
TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFRP2, or Secreted Frizzled-Related Protein 2, is a member of the SFRP family, which plays a crucial role in modulating the Wnt signaling pathway, a key regulator of various biological processes including cell proliferation, differentiation, and tissue homeostasis. Dysregulation of Wnt signaling has been implicated in numerous diseases, particularly cancer, where aberrant pathway activation can lead to tumorigenesis. As a secreted protein, SFRP2 functions as a decoy for Wnt ligands, inhibiting their interaction with Frizzled receptors and thereby influencing downstream signaling cascades. Research has shown that SFRP2 is differentially expressed in various cancer types, suggesting its potential as a biomarker for tumor progression. Moreover, SFRP2 has been associated with other physiological processes, such as embryonic development and tissue repair. Investigating the recombinant expression of SFRP2 is essential for understanding its functional mechanisms and therapeutic potential. By producing SFRP2 in a controlled environment, scientists can explore its role in regulating Wnt signaling and assess its implications in the context of cancer therapies and regenerative medicine, making it a significant target for further research in both basic and applied sciences.
