Cat: PA2000-1207

Recombinant Human gABRa3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    gABRa3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    gABRa3;Gamma-aminobutyric acid receptor subunit alpha-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34903

  • Expression Region

    30-492aa

  • AA Sequence

    GESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYD NRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKF DGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTL PYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNK SVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFV IQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSL PKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWEGKKVPEALE MKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGAAPSASSTPT IIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYV NRESAIKGMIRKQ

  • Molecular Weight

    77 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the gABRa3 recombinant protein is rooted in the broader understanding of the gamma-aminobutyric acid (GABA) receptor family, which plays a crucial role in mediating inhibitory neurotransmission in the central nervous system. GABA receptors are significant for maintaining neuronal excitability, and abnormalities in these pathways can lead to various neurological disorders such as epilepsy, anxiety, and depression. Among these receptors, the GABAA receptor subtype is particularly important due to its involvement in fast synaptic inhibition and its modulation by various pharmacological agents. The gABRa3 protein, a subunit of the GABAA receptor, has attracted substantial interest for its distinct properties and potential therapeutic implications. Research has focused on the expression and functional characterization of gABRa3 to elucidate its role in receptor assembly, pharmacological responsiveness, and its interaction with other subunits. Furthermore, generating recombinant gABRa3 protein enables detailed studies into receptor dynamics, ligand binding, and the effects of potential pharmacotherapeutics. Understanding gABRa3's mechanisms could lead to novel interventions for mitigating GABAergic dysfunctions, making it a promising target for drug development strategies aimed at treating disorders with GABAergic involvement. Overall, the exploration of gABRa3 recombinant protein enhances our comprehension of GABA receptor biology and paves the way for innovative approaches in treating related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US