Analytical Data
-
Gene name
NOPE
- Application
-
Alternative Names
Immunoglobulin superfamily DCC subclass member 4. Neighbor of punc e11. Protein DDM36. hDDM36
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDY8
-
Expression Region
1152-1250 aa
-
AA Sequence
DLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NOPE (Nucleolar Protein of 58 kDa) is a protein that has garnered attention in recent years due to its potential roles in cellular processes such as ribosome biogenesis, stress response, and apoptosis. Research indicates that NOPE is implicated in the nucleolar stress response, where it participates in the regulation of cell cycle progression and transcriptional control. Abnormal expression of NOPE has been linked to various diseases, including cancer, suggesting its function as a possible biomarker or therapeutic target. Furthermore, studies have shown that NOPE interacts with other cellular proteins, suggesting its involvement in complex signaling pathways. The ability to recombinantly express NOPE provides a valuable tool for elucidating its structure-function relationships and understanding its biological significance. The generation of recombinant NOPE also facilitates the investigation of its interactions with other proteins and its role in cellular stress responses, contributing to the broader understanding of nucleolar dynamics and its implications in health and disease. As the field of molecular biology continues to advance, understanding the mechanisms underlying NOPE's functions may reveal new avenues for therapeutic intervention, particularly in cancer treatment, thereby underscoring the importance of ongoing research into this intriguing protein.
