Cat: PA1000-2787

Recombinant Human RQCD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RQCD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CNOT9;RCD1;RQCD1;CCR4-NOT transcription complex subunit 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92600

  • Expression Region

    1-299aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMHSLATAAPVPTTLAQVDREKIYQWINELS SPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEI VNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRI MESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQL SKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDT TTKRWLAQLVKNLQEGQVTDPRGIPLPPQ

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The RQCD1 protein, a key player in cellular processes, has garnered attention in the field of molecular biology due to its involvement in various cellular mechanisms, including RNA processing and stress response. As part of the RQCD (Ribosome Quality Control and Degradation) family, RQCD1 is intricately linked to the regulation of protein synthesis and degradation, particularly under conditions of cellular stress or damage. Studies have shown that RQCD1 interacts with ribosomal components, influencing the translation fidelity and turnover of misfolded proteins. Given its pivotal role, research has aimed to elucidate the molecular pathways in which RQCD1 operates, as well as its impact on cellular homeostasis and response to stress. Furthermore, the dysregulation of RQCD1 expression has been implicated in various diseases, including cancer and neurodegenerative disorders, making it a target for therapeutic intervention. Understanding the structure, function, and regulatory mechanisms of RQCD1 is crucial for uncovering its potential as a biomarker or therapeutic target in disease contexts. As such, ongoing research continues to explore the functional dynamics of RQCD1 and its broader implications in cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US