Analytical Data
-
Gene name
RPS7
- Application
-
Alternative Names
RPS7;Small ribosomal subunit Protein eS7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62081
-
Expression Region
1-194aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMFSSSAKIVKPNGEKPDEFESGISQA LLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQ VRLVRELEKKFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVH DAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGV YKKLTGKDVNFEFPEFQL
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPS7, or Ribosomal Protein S7, is a crucial component of the ribosomal small subunit, playing a significant role in protein synthesis and cellular function. Its involvement in the ribosome assembly and the translation process underscores its importance in maintaining cellular homeostasis. Recent studies have implicated RPS7 in various biological processes, including cell proliferation, apoptosis, and the response to stress, making it a protein of interest in cancer research and other diseases. Abnormalities in RPS7 expression have been observed in several cancers, suggesting a potential role in tumorigenesis. As a result, understanding the structural and functional characteristics of RPS7 through recombinant protein studies is essential. The generation of recombinant RPS7 allows for in-depth analysis of its biochemical properties, interactions with other ribosomal proteins, and its role in ribosome biogenesis. This research can provide insights into the mechanisms by which RPS7 contributes to cellular processes and its potential as a therapeutic target. Furthermore, recombinant RPS7 can be utilized to explore its involvement in translational regulation and its interactions with various signaling pathways, which may shed light on its contribution to the pathology of diseases. The work surrounding RPS7 underscores the significance of ribosomal proteins in health and disease, highlighting the need for ongoing research into their functions and implications in various biological contexts.
