Analytical Data
-
Gene name
MADD
- Application
-
Alternative Names
MADD；DENN；IG20；KIAA0358；MAP kinase-activating death domain Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXG6
-
Expression Region
1409-1506aa
-
AA Sequence
YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ
-
Molecular Weight
18.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MADD (MAP-kinase Activating Death Domain) is a critical protein involved in various cellular processes, including apoptosis, cell proliferation, and the regulation of MAPK signaling pathways. The study of MADD has gained significant attention due to its implications in cancer biology, particularly its overexpression in several malignancies, which may contribute to tumor progression and resistance to therapy. MADD functions as a scaffold protein that enhances MAPK activation, linking different signaling cascades and influencing cellular responses to stress and growth signals. Recent research has focused on elucidating the structural characteristics of MADD and its interactions with other proteins within the MAPK pathway, aiming to identify potential therapeutic targets. Understanding the molecular mechanisms underlying MADD's role in cell signaling not only provides insights into tumor biology but also opens avenues for the development of novel therapeutic strategies aimed at disrupting MADD function in cancer cells. Consequently, investigating MADD and its restructured protein forms may yield significant advancements in our understanding of cancer mechanisms and improve treatment outcomes.
